Mostrando entradas con la etiqueta 3D-footprint. Mostrar todas las entradas
Mostrando entradas con la etiqueta 3D-footprint. Mostrar todas las entradas

19 de agosto de 2025

footprintDB release 19082025

Our https://footprintdb.eead.csic.es server has been updated, marking the 19082025 release. These are the most recent developments:

  • New plant DNA motifs and transcription factors (TFs) curated from the literature have been added to EEADannot
  • New protein-DNA complexes from https://3dfootprint.eead.csic.es have been added and used to annotate residue interfaces of all TFs.
  • The updated data can be downloaded at https://footprintdb.eead.csic.es/download
  • A new REST service has been set up to support amino acid sequence queries. It uses https://metacpan.org/pod/Mojolicious::Lite and can be queried with curl as follows, returning predicted DNA motifs in TRANSFAC format: 
  • curl -X POST -H "Content-Type: application/json" -d '{"q1":"MVAKVKRDGEVLVAAATGDSEEQDDLVLPGFRFHPTDEELVTFYLRRKVARKPLSMEIIKEMDIYKHDPWDLPKASTVGGEKEWYFFCLRGRKYRNSIRPNRVTGSGFWKATGIDRPIYPAAAGESVGLKKSLVYYRGSAGKGAKTDWMMHEFRLPPAASSPSTQEAVEVWTICRIFKRNIAYKKRQPAGSNAPPPPLAESSSNTGSFESGGGGDDGEYMNCLPVPVPATAAVVPRQQHRIGSMLNGGGVTASGSSFFREVGVHGQQFQGHWLNRFAAPEIERKPQLLGSSAMTIAFHQNDQTAATNECYKDGHWDEIARFMEVNDPTVLYDCRYA","q2":"IYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIEN"}' http://footprintdb.eead.csic.es:8080/protein 
These updates have also been propagated to the RSAT::Plants instance at http://plants.rsat.eu and https://github.com/rsa-tools/motif_databases/tree/master/footprintDB

Take care, Bruno

7 de enero de 2025

footprintDB January 2025 version

Hi, we just updated the motifs, transcription factors and sites in the database footprintDB

The January 2025 version adds:

1)  Motifs inferred from  protein-DNA complexes at the Protein Data Bank, added to 3d-footprint by  19/12/2024; note the complexes are also used to annotate interface residues  of all transcription factors (TFs).

2) New plant data at EEADannot, with TFs assigned to Plant-TFClass families (see repo).

The current contents include:


totaluniquemetazoaplants
Transcription Factors9976732248391256
DNA motifs (PSSM)171171482888932962
DNA Binding Sites/Sequences68358




The footprintDB motifs have also been synced with RSAT (see repo), see you soon,
Bruno

8 de enero de 2024

footprintDB added new TFs, cis elements and binding interfaces

Over the last couple of weeks I have carried out the annual update of footprintDB, our database of transcription factors (TFs) with annotated cis elements and binding interfaces.

This involved three consecutive steps:

1) Updated 3d-footprint (completed 21/12/2023). This means that the collection of protein-DNA complexes from the Protein Data bank was updated and will help annotate more interface residues in TFs.

2) Updated the EEADannot collection with plant motifs and sites manually curated by us from papers published recently. You can see the sources at https://github.com/eead-csic-compbio/EEADannot .

3) Added JASPAR 2024 data and predicted interface residues for all included TFs.

 

You can check the current contents of each collection at https://footprintdb.eead.csic.es/index.php?databases , an overall summary is shown here:

 


The data can be downloaded in FASTA and TRANSFAC formats at https://footprintdb.eead.csic.es/download and the motifs have also been updated in https://github.com/rsa-tools/motif_databases , which feeds RSAT servers (see the plants server here). Note that some collections were left out due to licensing limitations.

Bruno

7 de marzo de 2023

footprintDB moved to a new server

Dear all,

shortly after the changes reported on Twitter, our server footprintDB, first published in 2014, has moved to a new server.

The new URL is https://footprintdb.eead.csic.es and accesses to the old site [http://floresta.eead.csic.es/footprintdb] will be redirected here. 

Here's a summary of updates:

Motif of BIL1/BZR1, https://footprintdb.eead.csic.es/index.php?db:EEADannot&motif=BZR1.

 

Have a nice week,

Bruno