Our https://footprintdb.eead.csic.es server has been updated, marking the 19082025 release. These are the most recent developments:
- New plant DNA motifs and transcription factors (TFs) curated from the literature have been added to EEADannot
- New protein-DNA complexes from https://3dfootprint.eead.csic.es have been added and used to annotate residue interfaces of all TFs.
- The updated data can be downloaded at https://footprintdb.eead.csic.es/download
- A new REST service has been set up to support amino acid sequence queries. It uses https://metacpan.org/pod/Mojolicious::Lite and can be queried with curl as follows, returning predicted DNA motifs in TRANSFAC format:
curl -X POST -H "Content-Type: application/json" -d '{"q1":"MVAKVKRDGEVLVAAATGDSEEQDDLVLPGFRFHPTDEELVTFYLRRKVARKPLSMEIIKEMDIYKHDPWDLPKASTVGGEKEWYFFCLRGRKYRNSIRPNRVTGSGFWKATGIDRPIYPAAAGESVGLKKSLVYYRGSAGKGAKTDWMMHEFRLPPAASSPSTQEAVEVWTICRIFKRNIAYKKRQPAGSNAPPPPLAESSSNTGSFESGGGGDDGEYMNCLPVPVPATAAVVPRQQHRIGSMLNGGGVTASGSSFFREVGVHGQQFQGHWLNRFAAPEIERKPQLLGSSAMTIAFHQNDQTAATNECYKDGHWDEIARFMEVNDPTVLYDCRYA","q2":"IYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIEN"}' http://footprintdb.eead.csic.es:8080/protein
Take care, Bruno
No hay comentarios:
Publicar un comentario