Genome annotation with footprintDB

Hi,
some of you might have heard of our footprintDB collection, which is somewhat unique in that it annotates DNA motifs from different sources together with their cognate transcription factors (TF) and their interface residues. it was published in 2014 and is regularly updated and queried by users around the world, who usually perform interactive searches.

There is also a web services interface which is also quite useful, but slow if you have many sequences to scan (see examples in the manual). Things are even worse if you have a complete genome or proteome. And that's exactly what Teshome Mulugeta, who's visiting the lab from Norway, needed to do.

ACE2 DNA motif, taken from http://floresta.eead.csic.es/footprintdb/index.php?motif=cb6f6b343b895dfa1c3776c99fbedda7 .

So, we have made available FASTA files of all transcription factors in footprintDB, together with their cognate DNA motifs, at http://floresta.eead.csic.es/footprintdb/download . They come in three flavours (all, Metazoa and plants), and TF sequences look like this one:

>1:ACE2 [Saccharomyces cerevisiae] libs:JASPAR;CISBP; motif:vTGCTGGtym;mCCAGCa; url 
MDNVVDPWYINPSGFAKDTQDEEYVQHHDNVNPTIPPPDNYILNNENDDGLDNLLGMDYYNIDDLLTQELRDLDIPLVPSPKTGDGS
SDKKNIDRTWNLGDENNKVSHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILNMSKDPQPMELINELGNHNTVKNNNDDF
DHIRENDGENSYLSQVLLKQQEELRIALEKQKEVNEKLEKQLRDNQIQQEKLRKVLEEQEEVAQKLVSGATNSNSKPGSPVILKTPA
MQNGRMKDNAIIVTTNSANGGYQFPPPTLISPRMSNTSINGSPSRKYHRQRYPNKSPESNGLNLFSSNSGYLRDSELLSFSPQNYNL
NLDGLTYNDHNNTSDKNNNDKKNSTGDNIFRLFEKTSPGGLSISPRINGNSLRSPFLVGTDKSRDDRYAAGTFTPRTQLSPIHKKRE
SVVSTVSTISQLQDDTEPIHMRNTQNPTLRNANALASSSVLPPIPGSSNNTPIKNSLPQKHVFQHTPVKAPPKNGSNLAPLLNAPDL
TDHQLEIKTPIRNNSHCEVESYPQVPPVTHDIHKSPTLHSTSPLPDEIIPRTTPMKITKKPTTLPPGTIDQYVKELPDKLFECLYPN
CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKKYICPCGKRFNREDALMVHRSRMICTGGKKLEHSIN
KKLTSPKKSLLDSPHDTSPVKETIARDKDGSVLMKMEEQLRDDMRKHGLLDPPPSTAAHEQNSNRTLSNETDAL

The header contains the internal accession number, the main TF name, the organism name, the source libraries, the DNA motifs (from JASPAR and CISBP in the example) and a URL where the full annotation and references are available,
cheers,
Bruno

rendimiento multihebra de BLAST+ 2.6.0

Hola,
hace unas semanas descubrí gracias a mi colega Pablo Vinuesa que BLAST+ del NCBI iba ya por la versión 2.6.0. Cuando miré el resumen de cambios me llamó la atención que ya desde la versión 2.4 soporta un algoritmo multihebra para la fase reconstrucción hacia atrás del alineamiento, que en la literatura de programación dinámica se llama traceback. Dado que nosotros usamos con mucha frecuencia BLAST quise probar en qué se traducían estas novedades en tiempo de cálculo, dado que ya habíamos observado que BLASTP no paralelizaba bien, razón por la cual desarrollamos split_blast.pl, que recientemente comparamos contra DIAMOND.

El experimento consistió en buscar alineamientos locales de 48.588 secuencias de la variedad de cebada Haruna Nijo entre los 7.927 factores de transcripción de nuestra colección http://floresta.eead.csic.es/footprintdb:

$ ncbi-blast-2.2.30+/bin/makeblastdb -in footprintdb.18042017.tf.fasta -dbtype prot

$ time ~/soft/ncbi-blast-2.2.30+/bin/blastp -query HarunaNijo_proteins.fa \
  -db footprintdb.18042017.tf.fasta -outfmt 6 -max_target_seqs 10 \
  -num_threads 8 > HarunaNijo_proteins.2.2.30.blast

real  53m47.482s
user  122m2.375s
sys 0m9.749s

$ perl split_blast.pl 8 1000 ncbi-blast-2.2.30+/bin/blastp \

  -query HarunaNijo_proteins.fa -db footprintdb.18042017.tf.fasta -outfmt 6 \
  -max_target_seqs 10 -output HarunaNijo_proteins.split.blast

# runtime: 836 wallclock secs ( 0.71 usr  0.20 sys + 6391.38 cusr  5.54 csys = 6397.83 CPU)
# this is ~14m

$ ncbi-blast-2.6.0+/bin/makeblastdb -in footprintdb.18042017.tf.fasta -dbtype prot

$ time ncbi-blast-2.6.0+/bin/blastp -query HarunaNijo_proteins.fa \
  -db footprintdb.18042017.tf.fasta -outfmt 6 -max_target_seqs 10 \
  -num_threads 8 >   HarunaNijo_proteins.2.6.0.blast

real  20m35.969s
user  194m1.715s
sys 2m41.827s

Como podéis ver, al menos para BLASTP esta versión de BLAST+ supone una ganancia clara en procesadores multicore (8 en esta prueba), a costa de un aumento de tamaño del binario, que pasa de 31MB a 38MB, pero sigue siendo más lento que split_blast.pl,
hasta pronto,
Bruno

UniPROBE heterodimers in footprintDB

Hi,
we'd like to let you know that footprintDB, our database of transcription factors (TF), cognate binding sites and interface residues has been updated. Álvaro recently added the latest version of UniPROBE which systematically annotates some TF heterodimers. Their DNA motifs look like this:

Consensus DNA motif recognized by the dimer (MXL1 , MDL1), taken from footprintDB.

The non-redundant collection of motifs has been also updated in RSAT::Plants,
have a good week,
Bruno

ciencia básica = ciencia aplicada (fármacos aprobados)

Buenas,
hoy quisiera comentar un tema recurrente cuando hablamos de ciencia: el de ciencia básica vs ciencia aplicada. En general mi impresión es que la primera se percibe como un esfuerzo romántico que da sentido a la vida de algunos locos, mientras que la segunda es la que vale, puesto que participan ingenieros, y acaba llegando a nuestro smartphone en poco tiempo. Obviamente exagero, pero por ahí van los tiros.

La excusa para sacar este tema hoy es un artículo publicado recientemente en la revista Science (http://science.sciencemag.org/content/356/6333/78.full) donde se analiza cómo se citan los proyectos de Biomedicina financiados por los NIH norteamericanos en patentes. El estudio cubre los años entre 1980 y 2007. Las conclusiones de este trabajo son:

1) que si tenemos en cuenta las citas indirectas, es decir, patentes que citan artículos que a su vez citan proyectos NIH, finannciados con dinero público, hasta un 31% de proyectos en ese periodo son citados en patentes.

2) los proyectos citados en patentes que protegen fármacos aprobados por la FDA son en igual proporción "básicos" y "aplicados", según las definiciones de los autores, que son conscientes de lo resbaladizo de estos términos.

Figura tomada de http://science.sciencemag.org/content/356/6333/78.full

Hasta luego,
Bruno