15 de mayo de 2025

Descarga datasets del NCBI desde el terminal

Hola, hace unos días necesitaba obtener todas las secuencias de genes de pimiento (Capsicum annuum) de la colección 'gene' del NCBI (que tan mal lo está pasando en 2025). Para ello abrí el navegador y obtuve una lista de 48K identificadores (gene-id) en https://www.ncbi.nlm.nih.gov/gene?term=capsicum%20annuum%5BOrganism%5D

Descargué el fichero y lo hice no redundante de esta manera:

$ head -3 gene_result.txt | cut -f 1-6
tax_id Org_name GeneID CurrentID Status Symbol
4072 Capsicum annuum 107859632 0 live LOC107859632
4072 Capsicum annuum 107868427 0 live LOC107868427 
$ cut -f 3 gene_result.txt | sort -u | grep -v Gene > pimiento.geneids.txt

Descubrí que obtener la lista de genes es fácil, pero no tanto sus secuencias. Por ejemplo no lo logré con https://www.ncbi.nlm.nih.gov/sites/batchentrez , me daba secuencias que no eran de pimiento, supongo que por esperar otro tipo de identificadores. Entonces pedí ayuda en https://support.nlm.nih.gov/support/create-case y tras unos días de espera me dirigieron amablemente a la documentación de la herramienta datasets del NCBI, y me compartieron la siguiente figura:


Me descargué el binario datasets para linux de https://www.ncbi.nlm.nih.gov/datasets/docs/v2/command-line-tools/download-and-install y lo utilicé de esta manera:

$ chmod +x datasets
# probamos primero con un gen de ejemplo 
$ ./datasets download gene gene-id 20217883 --include gene,protein
Collecting 1 gene record [================================] 100% 1/1
Downloading: ncbi_dataset.zip 3.24kB valid data package
Validating package files [================================] 100% 5/5
$ unzip ncbi_dataset.zip
Archive: ncbi_dataset.zip
inflating: README.md
inflating: ncbi_dataset/data/gene.fna
inflating: ncbi_dataset/data/data_report.jsonl
inflating: ncbi_dataset/data/dataset_catalog.json
inflating: md5sum.txt
$ head ncbi_dataset/data/gene.fna
>NC_024624.1:447314-449261 rrn18 [organism=Capsicum annuum] [GeneID=20217883] [chromosome=MT]
ATCATAGTCAAAAGAAGAGTTTGATCCTGGCTCAGAAGGAACGCTAGCTATATGCTTAACACATGCAAGT
CGAACGTTGTTTTCGGGGAGCTGGGCAGAAGGAAAAGAGGCTCCTAGCTAAAGGTAGCTTGTCTCGCCCA
GGAGGTGAGAAGAGTTGAGAACAAAGTGGCGAACGGGTGCGTAACGCGTGGGAATCTGCCGAACAGTTCG
GGCCAAATCCTGAAGAAAGCTAAAAAGCGCTGTTTGATGAGCCTGCGTAGTATTAGGTAGTTGGTCAGGT
AAAGGCTGACCAAGCCAATGATGCTTAGCTGGTCTTTTCGGATGATCAGCCACACTGGGACTGAGACACG
GCCCGGACTCCCACGGGGGGCAGCAGTGGGGAATCTTGGACAATGGGCGAAAGCCCGATCCAGCAATATC
GCGTGAGTGAAGAAGGGCAATGCCGCTTGTAAAGCTCTTTCGTCGAGTGCGCGATCATGACAGGACTCGA
GGAAGAAGCCCCGGCTAACTCCGTGCCAGCAGCCGCGGTAAGACGGGGGGGGCAAGTGTTCTTCGGAATG
ACTGGGCGTAAAGGGCACGTAGGCGGTGAATCGGGTTGAAAGTGAAAGCCGCCAAAAACTGGCGGAATGC
 
# ahora con gene-ids del fichero que preparamos antes, tarda, ncbi_dataset.zip > 100MB
$ ./datasets download gene gene-id --inputfile pimiento.geneids.txt --include gene,protein
$ unzip ncbi_dataset.zip 
Archive: ncbi_dataset.zip
inflating: README.md
inflating: ncbi_dataset/data/gene.fna
inflating: ncbi_dataset/data/protein.faa
inflating: ncbi_dataset/data/data_report.jsonl
inflating: ncbi_dataset/data/dataset_catalog.json
inflating: md5sum.txt
 
$ head ncbi_dataset/data/gene.fna
>NW_025826840.1:c5280-2277 LOC124890618 [organism=Capsicum annuum] [GeneID=124890618] [chromosome=Un]
GGAGGTACTTAAAGCATGACTTTTAAAAGTTTGCATAGGGCAAGAAGCAGGAGTGTGACTAAACTGATTT
TTCTTTCTGGTTTTAAGCATGATGCTATTCCTCAGCGTCCTCAAAATGAGCAAATTGAAAAGCTCAAGAA
GTTCAAGGCTGTGTTGGAACGCATTCTGATTTTCTTGCAGCTCAATAAGCATGACATTCAGCTTACTCAC
AAGGAGAAGTTGTGTTCGGTTGAGAGGCACATAGGTTTCTTTCTTAGCAAGCCTACTTCTCCTCCTCTGC
AGGGGCAACTTCCTCAGTCTTCCATGCAGCTTCAGCAACCACAATCACTTGATGTTCAAACTAATCCACC
GATGCAACCTCAACTTCATCAGGCACTATCTTCGCAGGTACGTCATCAACATTTTAATCCACTATTATCA
TTTCTGGAGGCAATTCTACCAATTGTATGGTGCATCATGCTGGATTTACTAAATTTTGATACTATAAAAG
GTCTCTTGACAAACAGCTAGCCAAATGTGTCAGTCGTCATTGAAAGTTCTGCTACCGTTTAGTTTCTTTT
TCTCCAATGTCTTTTGTTACACTTGTTTTGTATATTACTATATTGTTGGCTCTTTTTCTTTCTTTTGATC
$ head ncbi_dataset/data/protein.faa 
>XP_047258369.1 LOC124890618 [organism=Capsicum annuum] [GeneID=124890618]
MTFKSLHRARSRSVTKLIFLSGFKHDAIPQRPQNEQIEKLKKFKAVLERILIFLQLNKHDIQLTHKEKLC
SVERHIGFFLSKPTSPPLQGQLPQSSMQLQQPQSLDVQTNPPMQPQLHQALSSQAQSTGALQTATLDSDS
TSQTGNADGADWQEELYQEIKTMREKNLPELNALYQKIASKVQQHDAIPQRPQNEQIEKLKMFKAVLERI
LIFLQVNKHDIQLTHKEKLCSVERHIGFFLSKPTSPPLQGQLPQSSMQLQQPQSLDVQTNPPMQPQLHQA
LSSQAQSTGALQTATLDSDSTSQTGNADGADWQEELYQEIKTMRDKNLPELNA
>XP_047259376.1 LOC124891834 [organism=Capsicum annuum] [GeneID=124891834]
MTSNITESLNSILRDEREYPVASIFNSIAPRFGEIFRKRYAEVDNSKTTFIPVAETILRENMTKGDKLYV
NNINESTNEFTVLGYGRSAKVNLSRQPCSCRKYDLVKLPCAYTMAALHLKHGDEYGTSIYKNPFQIYSKE
SYLLAYLEPICAAPLESEWSVAREYLEIQVLPPDVDPKHGRRKVKHVKGVLEPSRYKKRNKCSKCKRLGH

Hay muchas otras maneras de utilizarlo y ejemplos en https://www.ncbi.nlm.nih.gov/datasets/docs/v2/how-tos

Hasta pronto, Bruno

 

29 de abril de 2025

Uso aceptable de modelos de lenguaje según la ISCB

En este blog ya hemos hablado de los grandes modelos de lenguaje (LLMs por sus siglas en inglés) como ChatGPT. Esa entrada fue en 2023 y desde entonces hemos presenciado como su uso se extiende en todos los ámbitos, desde el móvil, los colegios o las empresas.

En ciencia también se han extendido mucho. Por ejemplo en el 1er congreso de la SEBiBC hubo una sesión dedicada a la IA donde se trataron. En mi caso, tengo instalado en mi máquina deepseek-r1:14b y qwen2.5-coder:latest sobre ollama y VSCode, y me ayudan a escribir código. Pero para qué usos es lícito usarlos en ciencia? 

La sociedad internacional de biología computacional (ISCB), con sede en EEUU, ha publicado a primeros de abril una guía breve, que dicen actualizarán según sea necesario. Al paso que va todo no creo que tarden mucho...

Como la ISCB tiene su sede en EEUU menciona entidades como el NIH; en cualquier caso pueden aplicarse con pocos cambios a otros ámbitos. La copio y pego aquí en inglés:

Confidentiality

When using commercial LLMs. such as ChatGPT or Gemini, data may be reused and thus it is important that confidential or personal information is not shared. This is particularly important with respect to peer review. The NIH currently forbids the use of LLMs in peer review for this reason (see NIH policy). Many Institutions have also developed further policies that may apply. Below we list the acceptable and unacceptable uses of LLMs and related technologies. Note that acceptable use cases only apply where confidentiality is not an issue.

Unacceptable Uses
It is not acceptable to use LLMs or related technologies to draft paper sections. In essence, papers MUST be written by humans.
It is not acceptable to use LLMs or related technologies to carry out reviewing activities, such as scientific peer reviews and promotion and tenure reviews. Firstly, these are an important part of the scientific process and they require scientific judgement. Secondly, review processes are in general confidential and should not be shared with third parties, including commercial LLM providers.
LLMs cannot be listed as authors as they do not fulfill the requirements of authorship as laid out in the ICMJE guidelines.

Acceptable Uses
As an algorithmic technique for research study in your research e.g. LLMs for protein structure prediction.
As an aid to correct written text (spell checkers, grammar checkers).
As an aid to language translation, however, the human is responsible for the accuracy of the final text.
As an evaluation technique (to assist in finding inconsistencies or other anomalies).
It is permissible to include LLM generated text snippets as examples in research papers where appropriate, but these MUST be clearly labeled and their use explained.
Assist in code writing, however, the human is responsible for the code.
Create documentation for code, however, the human is responsible for the correct documentation.
To discover background information on a topic, subject to verification from trusted sources.


Fuente: https://www.iscb.org/iscb-policy-statements/iscb-policy-for-acceptable-use-of-large-language-models

Hasta pronto