19 de agosto de 2025

footprintDB release 19082025

Our https://footprintdb.eead.csic.es server has been updated, marking the 19082025 release. These are the most recent developments:

  • New plant DNA motifs and transcription factors (TFs) curated from the literature have been added to EEADannot
  • New protein-DNA complexes from https://3dfootprint.eead.csic.es have been added and used to annotate residue interfaces of all TFs.
  • The updated data can be downloaded at https://footprintdb.eead.csic.es/download
  • A new REST service has been set up to support amino acid sequence queries. It uses https://metacpan.org/pod/Mojolicious::Lite and can be queried with curl as follows, returning predicted DNA motifs in TRANSFAC format: 
  • curl -X POST -H "Content-Type: application/json" -d '{"q1":"MVAKVKRDGEVLVAAATGDSEEQDDLVLPGFRFHPTDEELVTFYLRRKVARKPLSMEIIKEMDIYKHDPWDLPKASTVGGEKEWYFFCLRGRKYRNSIRPNRVTGSGFWKATGIDRPIYPAAAGESVGLKKSLVYYRGSAGKGAKTDWMMHEFRLPPAASSPSTQEAVEVWTICRIFKRNIAYKKRQPAGSNAPPPPLAESSSNTGSFESGGGGDDGEYMNCLPVPVPATAAVVPRQQHRIGSMLNGGGVTASGSSFFREVGVHGQQFQGHWLNRFAAPEIERKPQLLGSSAMTIAFHQNDQTAATNECYKDGHWDEIARFMEVNDPTVLYDCRYA","q2":"IYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIEN"}' http://footprintdb.eead.csic.es:8080/protein 
These updates have also been propagated to the RSAT::Plants instance at http://plants.rsat.eu and https://github.com/rsa-tools/motif_databases/tree/master/footprintDB

Take care, Bruno